PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT32483
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 100aa    MW: 11471.4 Da    PI: 10.2396
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT32483genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66e-181663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
         EMT32483 16 RGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                     89******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-25766IPR009057Homeodomain-like
PROSITE profilePS5129421.3351167IPR017930Myb domain
SMARTSM007172.4E-131565IPR001005SANT/Myb domain
PfamPF002492.0E-161663IPR001005SANT/Myb domain
SuperFamilySSF466895.99E-251792IPR009057Homeodomain-like
CDDcd001673.43E-111863No hitNo description
PROSITE profilePS500904.4956491IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.1E-106791IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNRGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTVEEEETL IKLHNMLGNK YVHHLPLAAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-17149225102MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2486491e-124AK248649.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf178a22, mRNA sequence.
GenBankAK3696891e-124AK369689.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095N02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006653723.11e-59PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-56MYB1_MAIZE; Myb-related protein Zm1
TrEMBLM8CE593e-70M8CE59_AEGTA; Myb-related protein Zm1
STRINGOB04G30570.13e-59(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.17e-53myb domain protein 63